homegearguru.in homegearguru.in - Best Home & Kitchen Appliances In India - Review & Guide

homegearguru.inWebsite Profile

Title: Best Home & Kitchen Appliances In India - Review & Guide
Keywords:
Description:Review & Guide
lptelecom.ca is ranked 25408406 in the world (amongst the 40 million domains). A low-numbered rank means that this website gets lots of visitors. This site is relatively popular among users in the united states. It gets 50% of its traffic from the united states .This site is estimated to be worth $2,503. This site has a low Pagerank(0/10). It has 1 backlinks. lptelecom.ca has 43% seo score.

homegearguru.in Information

Website / Domain:homegearguru.in
Website IP Address:198.71.233.5
Domain DNS Server:ns75.domaincontrol.com,ns76.domaincontrol.com

homegearguru.in ranks

Alexa Rank:0
EveryoneDomain Rank:0
Google Page Rank:0/10 (Google Pagerank Has Been Closed)

homegearguru.in Traffic & Earnings

Purchase/Sale Value:$0
Daily Revenue:$0
Monthly Revenue:$0
Yearly Revenue:$$0
Daily Unique Visitors:0
Monthly Unique Visitors:0
Yearly Unique Visitors:0

homegearguru.in WebSite Httpheader

StatusCode 200
Transfer-Encoding chunked
Vary Accept-Encoding, User-Agent
Cache-Control no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content-Type text/html; charset=UTF-8
Date Mon, 22 Oct 2018 18:14:40 GMT

homegearguru.in WebSite Httpheader

Keyword Count Percentage

homegearguru.in Similar Website

Domain WebSite Title
bestappliancesreview.com Best Appliances Review - Your Source for Home and Kitchen Appliances Review
homeandkitchenappliancesreview.com Home and Kitchen Appliances Review
allkitchen.net All Kitchen & Household Appliances | Your best review guide for kitchen and household appliances!
bossindia.com Boss India - Best Home & Kitchen Appliances Manufacturers in India
besthomeandkitchenappliances.com Best Home And Kitchen Appliances
cataindia.com Kitchen Appliances and Buy Home Appliances Online at Best Appliances Price in India : CATA Applianc...
cataindia.in Built in Kitchen Appliances & Buy Home Appliances Online at Best Appliances Price in India :CATAIND...
morphyrichardsindia.com Buy Morphy Richards Kitchen & Home Appliances Online in India at Best Price
kitchenappliancereview.com Kitchen Appliance Review | kitchen Appliances For The Home
baltra.in Home Appliances Manufacturers India,Electrical Appliances,Kitchen Appliances Manufacturers India
sanford.in SANFORD - Home and kitchen appliances in india
glenindia.com Home & Kitchen Appliances India, Buy Kitchen Appliances Online- Glen India
fabianoappliances.com Fabiano: Kitchen Appliances Suppliers India - Home Appliances India
fabiano.co.in Home Kitchen Appliances Company - Best Kitchen and Home Appliances
allkitchenappliance.com Best Kitchen & Home Appliances | New High-Tech Kitchen Appliances
elementme.com Best kitchen appliances dubai | home kitchen appliances in dubai , uae
reviewsera.com Reviews & Ratings Of Home & Kitchen Appliances In India | ReviewsEra
vitek.in Home & Kitchen appliances | Beauty & Grooming - Vitek India

homegearguru.in Alexa Rank History Chart

homegearguru.in aleax

homegearguru.in Html To Plain Text

Best Home & Kitchen Appliances In India - Review & Guide Home Reviews Editors Choice Infographic About Contact us 0 HUL Pureit WPAD100 Advanced 23-Litre Water Purifier Review – Good quality and Affordable Water is the most important element of our life and its purify affects a lot to our health. In developing countries, the water that comes from the tap is unfit for drinking and there is a need for the water purification system in every household. While selecting a water purifier, the most important factors is […] Continue reading Avik sengupta Reviews 0 Glen GL4043Plus 250-Watt 0.4-Litre Mini Chopper Review It can become hectic to use a food processor if you have a small family and generally cook for two or three people. The food processor will take lots of time to clean, even you need to use it for a small amount of food. In that case, the best thing you can bring to […] Continue reading Avik sengupta Reviews 0 Black & Decker CJ650 30-Watt Citrus Juicer Review – Worth Buying? Citrus juicers are the perfect device to create healthy and delicious juices. It can be used anywhere as per demand for fresh squeezed juice. No matter you want to make juice for home or office, the citrus juicers can perform this duty easily. The citrus juices can help you in improving mental functioning as well […] Continue reading Avik sengupta Reviews 0 Bajaj FX 11 600-Watt Food Factory Food Processor Review You desperately need a food processor if you are fed up of doing dicing, chopping and making chutney. An ideal food processor will help you with all the manual task before starting cooking with fruits or vegetables. This extraordinary machine will work as your assistant in the kitchen who will help you with everything of […] Continue reading Avik sengupta Reviews 0 Koryo KSJ 1501 150W Cold Press Healthy Slow Juicer vs Premsons Slow Juicer Having a mixer grinder in your kitchen is very important. It reduces the labour and helps you to make healthy juices fast. Since there are a number of juicers available in the market, it is quite difficult to choose the right one. Amongst the many brands that are highly popular in the recent time, the […] Continue reading Avik sengupta HOW-TO-CHOOSE 0 Best Selling Refrigerator Brands in India Summer is here and now it’s time to have some chilled water and soft drinks to quench your thirst. If you are thinking of buying a refrigerator this summer and wondering which is the best refrigerator brand in the Indian market, then you have landed up at the right place. Here you will get detailed […] Continue reading Avik sengupta BEST BRANDS 0 Everything you need to know before buying an Air Conditioner for your home Are you planning to buy an air conditioner? It’s a great idea but one needs to gain knowledge before choosing an AC. Air-conditioners vary in cooling capacity, energy usage and price. You should choose the type of AC which is suitable for your room size or the window opening in your room. How to Choose […] Continue reading Avik sengupta HOW-TO-CHOOSE 0 Wet Grinder Selection Guide – What and all to Check before Buying one for your Home Kitchen is the most important place in a household. It is the place where the homemaker or the cook prepares food and the food brings the entire family together. In the past eras, people had the time to make food preparations by hand. Even the technology was not so advanced that the cooks could take […] Continue reading Avik sengupta HOW-TO-CHOOSE 0 Front load washing machine vs Top load washing machine – Which one best fit for you? So, you want to buy a washing machine for your home, right? The washing machine market won’t disappoint you. But, with the array of options, especially with the two types of the washing machines, it can indeed become a difficult choice to make, whether you should choose a front loading washing machine or a top […] Continue reading Avik sengupta HOW-TO-CHOOSE 0 Vacuum Cleaner Selection Guide for your Home When you are standing in a departmental store and looking at a new row of vacuum cleaners, how do you make headways of separating these vacuums from one another? Choosing a perfect model requires a little time and effort to analyze what you would like to clean. Generally speaking, there are mainly five types of […] Continue reading Avik sengupta HOW-TO-CHOOSE 1 2 3 … 8 Next ? Trending Posts Today Best Cold Press Juicer to Buy in India in 2017 Best 1 Ton Air Conditioner to Buy in India in 2017 Everything you need to know before buying an Air Conditioner All Time Popular Posts Best Home Theater System India – Guide & Reviews Best 1 Ton Air Conditioner to Buy in India in 2017 Best Chopper In India – Guide & Reviews Best Gas Stove in India – Guide & Reviews Best 3 Burner Gas Stove for your home to buy in 2017 Best Dishwasher In India – Guide & Reviews Best Wet Grinder for Indian Cooking – Guide & Reviews Best Masticating Juicer to buy online in 2017 in India Best Citrus Juicer In India – Guide & Reviews Best Clothes Drying Rack or Stand to buy online in India About Contact us Affiliate Disclosure Privacy Policy Copyright 2016 by homegearguru.in

homegearguru.in Whois

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
Domain ID:D414400000001348623-AFIN
Domain Name:HOMEGEARGURU.IN
Created On:17-Jul-2016 09:19:35 UTC
Last Updated On:15-Sep-2016 19:21:46 UTC
Expiration Date:17-Jul-2019 09:19:35 UTC
Sponsoring Registrar:GoDaddy.com, LLC (R101-AFIN)
Status:CLIENT DELETE PROHIBITED
Reason:
Status:CLIENT RENEW PROHIBITED
Reason:
Status:CLIENT TRANSFER PROHIBITED
Reason:
Status:CLIENT UPDATE PROHIBITED
Reason:
Registrant ID:CR247472733
Registrant Name:Lakshmi B
Registrant Organization:
Registrant Street1:Velachery
Registrant Street2:
Registrant Street3:
Registrant City:chennai
Registrant State/Province:Tamil Nadu
Registrant Postal Code:600042
Registrant Country:IN
Registrant Phone:+91.60144360
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Email:lakshmi.bhome@gmail.com
Admin ID:CR247472735
Admin Name:Lakshmi B
Admin Organization:
Admin Street1:Velachery
Admin Street2:
Admin Street3:
Admin City:chennai
Admin State/Province:Tamil Nadu
Admin Postal Code:600042
Admin Country:IN
Admin Phone:+91.60144360
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Email:lakshmi.bhome@gmail.com
Tech ID:CR247472734
Tech Name:Lakshmi B
Tech Organization:
Tech Street1:Velachery
Tech Street2:
Tech Street3:
Tech City:chennai
Tech State/Province:Tamil Nadu
Tech Postal Code:600042
Tech Country:IN
Tech Phone:+91.60144360
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Email:lakshmi.bhome@gmail.com
Name Server:NS75.DOMAINCONTROL.COM
Name Server:NS76.DOMAINCONTROL.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigne


The data contained in Everyone.domains, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of EveryOne.domains, LLC.By submitting an inquiry,
you agree to these terms of usage and limitations of warranty.In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam.You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.


Please note: the registrant of the domain name is specified
in the "registrant" section.In most cases, Everyone.domains, LLC
is not the registrant of domain names listed in this database.";

For more information on Whois status codes, please visit
https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en